SMARCA4, Recombinant, Human, aa1480-1603, GST-tag (SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily A Member 4, BRG1)

Produktübersicht

• Artikelname: SMARCA4, Recombinant, Human, aa1480-1603, GST-tag (SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily A Member 4, BRG1)
• Artikelnummer: USB-298461
• Hersteller Artikelnummer: 298461
• Alternativnummer: USB-298461-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Recombinant protein corresponding to a single bromodomain, aa1480-1603, from human SMARCA4, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSAEKLS PNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKE RIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Molekulargewicht: 41.3
• NCBI: 1128849
• UniProt: P51532
• Reinheit: Highly Purified (~96%)
• Formulierung: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.