SMARCA4, Recombinant, Human, aa1480-1603, GST-tag (SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily A Member 4, BRG1)

Product Overview

• Article Name: SMARCA4, Recombinant, Human, aa1480-1603, GST-tag (SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily A Member 4, BRG1)
• Biozol Catalog Number: USB-298461
• Supplier Catalog Number: 298461
• Alternative Catalog Number: USB-298461-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Recombinant protein corresponding to a single bromodomain, aa1480-1603, from human SMARCA4, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSAEKLS PNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKE RIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 41.3
• NCBI: 1128849
• UniProt: P51532
• Purity: Highly Purified (~96%)
• Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.