SMARCA4, Recombinant, Human, aa1480-1603, GST-tag (SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily A Member 4, BRG1)
Biozol Catalog Number:
USB-298461
Supplier Catalog Number:
298461
Alternative Catalog Number:
USB-298461-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Recombinant protein corresponding to a single bromodomain, aa1480-1603, from human SMARCA4, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSAEKLS PNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKE RIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.