CD74, Recombinant, Mouse, aa56-279, His-Tag (H-2 Class II Histocompatibility Antigen gamma Chain)

Artikelnummer: USB-370554
Artikelname: CD74, Recombinant, Mouse, aa56-279, His-Tag (H-2 Class II Histocompatibility Antigen gamma Chain)
Artikelnummer: USB-370554
Hersteller Artikelnummer: 370554
Alternativnummer: USB-370554-20,USB-370554-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. Partial recombinant protein corresponding to aa56-279 from mouse Cd74 at the extracellular domain, fused to 6X His-Tag at N-Terminal, expressed in E. coli. Uniprot/Swiss Accession: P04441 Molecular Weight: ~29.4kD Amino Acid Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29.4
UniProt: P04441
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 100mM Tris-HCl, 0.4M arginine, pH 8.0, 50% glycerol