CD74, Recombinant, Mouse, aa56-279, His-Tag (H-2 Class II Histocompatibility Antigen gamma Chain)

Catalog Number: USB-370554
Article Name: CD74, Recombinant, Mouse, aa56-279, His-Tag (H-2 Class II Histocompatibility Antigen gamma Chain)
Biozol Catalog Number: USB-370554
Supplier Catalog Number: 370554
Alternative Catalog Number: USB-370554-20,USB-370554-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. Partial recombinant protein corresponding to aa56-279 from mouse Cd74 at the extracellular domain, fused to 6X His-Tag at N-Terminal, expressed in E. coli. Uniprot/Swiss Accession: P04441 Molecular Weight: ~29.4kD Amino Acid Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.4
UniProt: P04441
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 100mM Tris-HCl, 0.4M arginine, pH 8.0, 50% glycerol