HLA class I Histocompatibility Antigen, alpha Chain G Protein, Recombinant, Human, aa25-338, His-SUMO-Tag (HLAG)

Artikelnummer: USB-370644
Artikelname: HLA class I Histocompatibility Antigen, alpha Chain G Protein, Recombinant, Human, aa25-338, His-SUMO-Tag (HLAG)
Artikelnummer: USB-370644
Hersteller Artikelnummer: 370644
Alternativnummer: USB-370644-20,USB-370644-100,USB-370644-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells. Partial rcombinant protein corresponding to aa25-338 from human HLAG, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. UniProt Accession: P17693 AA Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 51.6
UniProt: P17693
Reinheit: 90% (SDS-PAGE) Affinity Purified
Formulierung: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.