HLA class I Histocompatibility Antigen, alpha Chain G Protein, Recombinant, Human, aa25-338, His-SUMO-Tag (HLAG)
Biozol Catalog Number:
USB-370644
Supplier Catalog Number:
370644
Alternative Catalog Number:
USB-370644-20,USB-370644-100,USB-370644-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells. Partial rcombinant protein corresponding to aa25-338 from human HLAG, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. UniProt Accession: P17693 AA Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
