HupB, Recombinant, Salmonella Typhi, aa1-90, His-Tag (DNA-binding Protein HU-beta)

Produktübersicht

• Artikelname: HupB, Recombinant, Salmonella Typhi, aa1-90, His-Tag (DNA-binding Protein HU-beta)
• Artikelnummer: USB-370651
• Hersteller Artikelnummer: 370651
• Alternativnummer: USB-370651-20,USB-370651-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. Source: Recombinant protein corresponding to aa1-90 from full length S. typhi HupB, fused to His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~29.2kD Amino Acid Sequence: MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 29.2
• UniProt: P0A1R9
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.