BFRF3, Recombinant, Epstein-Barr Virus, aa31-176, His-SUMO-Tag (Capsid Protein VP26)

Artikelnummer: USB-372445
Artikelname: BFRF3, Recombinant, Epstein-Barr Virus, aa31-176, His-SUMO-Tag (Capsid Protein VP26)
Artikelnummer: USB-372445
Hersteller Artikelnummer: 372445
Alternativnummer: USB-372445-20,USB-372445-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa31-176 from Epstein-Barr virus BFRF3, fused to His-SUMO-Tag at N-termnal, expressed in E. coli. Molecular Weight: ~30.7kD Amino Acid Sequence: NQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 30.7
UniProt: P14348
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.