BFRF3, Recombinant, Epstein-Barr Virus, aa31-176, His-SUMO-Tag (Capsid Protein VP26)

Product Overview

• Article Name: BFRF3, Recombinant, Epstein-Barr Virus, aa31-176, His-SUMO-Tag (Capsid Protein VP26)
• Biozol Catalog Number: USB-372445
• Supplier Catalog Number: 372445
• Alternative Catalog Number: USB-372445-20,USB-372445-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa31-176 from Epstein-Barr virus BFRF3, fused to His-SUMO-Tag at N-termnal, expressed in E. coli. Molecular Weight: ~30.7kD Amino Acid Sequence: NQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 30.7
• UniProt: P14348
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.