C9orf23, Recombinant, Human, aa1-163, GST-Tag (Alba-like Protein C9orf23)

Artikelnummer: USB-372527
Artikelname: C9orf23, Recombinant, Human, aa1-163, GST-Tag (Alba-like Protein C9orf23)
Artikelnummer: USB-372527
Hersteller Artikelnummer: 372527
Alternativnummer: USB-372527-20,USB-372527-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May be a component of ribonuclease P or MRP. Source: Recombinant protein corresponding to aa1-163 from human C9orf23, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.6kD Amino Acid Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 44.6
UniProt: Q8N5L8
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.