C9orf23, Recombinant, Human, aa1-163, GST-Tag (Alba-like Protein C9orf23)

Product Overview

• Article Name: C9orf23, Recombinant, Human, aa1-163, GST-Tag (Alba-like Protein C9orf23)
• Biozol Catalog Number: USB-372527
• Supplier Catalog Number: 372527
• Alternative Catalog Number: USB-372527-20,USB-372527-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May be a component of ribonuclease P or MRP. Source: Recombinant protein corresponding to aa1-163 from human C9orf23, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.6kD Amino Acid Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 44.6
• UniProt: Q8N5L8
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.