CD3E, Recombinant, Human, aa23-207, GST-Tag (T-Cell Surface Glycoprotein CD3 epsilon Chain)

Artikelnummer: USB-372665
Artikelname: CD3E, Recombinant, Human, aa23-207, GST-Tag (T-Cell Surface Glycoprotein CD3 epsilon Chain)
Artikelnummer: USB-372665
Hersteller Artikelnummer: 372665
Alternativnummer: USB-372665-20, USB-372665-100, USB-372665-1
Hersteller: US Biological
Kategorie: Molekularbiologie
The CD3 complex mediates signal transduction. Source: Recombinant protein corresponding to aa23-207 from human CD3E, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.7kD Amino Acid Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 47.7
UniProt: P07766
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.