CD3E, Recombinant, Human, aa23-207, GST-Tag (T-Cell Surface Glycoprotein CD3 epsilon Chain)

Product Overview

• Article Name: CD3E, Recombinant, Human, aa23-207, GST-Tag (T-Cell Surface Glycoprotein CD3 epsilon Chain)
• Biozol Catalog Number: USB-372665
• Supplier Catalog Number: 372665
• Alternative Catalog Number: USB-372665-20, USB-372665-100, USB-372665-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The CD3 complex mediates signal transduction. Source: Recombinant protein corresponding to aa23-207 from human CD3E, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.7kD Amino Acid Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 47.7
• UniProt: P07766
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.