CELA3A, Recombinant, Human aa29-270, His-SUMO-Tag (Chymotrypsin-like Elastase Family Member 3A)

Artikelnummer: USB-372718
Artikelname: CELA3A, Recombinant, Human aa29-270, His-SUMO-Tag (Chymotrypsin-like Elastase Family Member 3A)
Artikelnummer: USB-372718
Hersteller Artikelnummer: 372718
Alternativnummer: USB-372718-20, USB-372718-100, USB-372718-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Efficient protease with alanine specificity but only little elastolytic activity. Recombinant protein corresponding to aa29-270 from human CELA3A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.6kD Amino Acid Sequence: VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.6
UniProt: P09093
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.