CELA3A, Recombinant, Human aa29-270, His-SUMO-Tag (Chymotrypsin-like Elastase Family Member 3A)

Product Overview

• Article Name: CELA3A, Recombinant, Human aa29-270, His-SUMO-Tag (Chymotrypsin-like Elastase Family Member 3A)
• Biozol Catalog Number: USB-372718
• Supplier Catalog Number: 372718
• Alternative Catalog Number: USB-372718-20, USB-372718-100, USB-372718-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Efficient protease with alanine specificity but only little elastolytic activity. Recombinant protein corresponding to aa29-270 from human CELA3A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.6kD Amino Acid Sequence: VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 42.6
• UniProt: P09093
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.