Collagen alpha-1(I) Chain, Recombinant, Rat, aa955-1207, His-Tag

Produktübersicht

• Artikelname: Collagen alpha-1(I) Chain, Recombinant, Rat, aa955-1207, His-Tag
• Artikelnummer: USB-372832
• Hersteller Artikelnummer: 372832
• Alternativnummer: USB-372832-20,USB-372832-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Type I collagen is a member of group I collagen (fibrillar forming collagen). Source: Recombinant protein corresponding to aa955-1207 from rat Collagen alpha-1(I) Chain, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.4kD Amino Acid Sequence: QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 25.4
• UniProt: P02454
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.