Collagen alpha-1(I) Chain, Recombinant, Rat, aa955-1207, His-Tag

Catalog Number: USB-372832
Article Name: Collagen alpha-1(I) Chain, Recombinant, Rat, aa955-1207, His-Tag
Biozol Catalog Number: USB-372832
Supplier Catalog Number: 372832
Alternative Catalog Number: USB-372832-20,USB-372832-100
Manufacturer: US Biological
Category: Molekularbiologie
Type I collagen is a member of group I collagen (fibrillar forming collagen). Source: Recombinant protein corresponding to aa955-1207 from rat Collagen alpha-1(I) Chain, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.4kD Amino Acid Sequence: QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.4
UniProt: P02454
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.