CXXC4, Recombinant, Human, aa1-198, GST-Tag (CXXC-type Zinc Finger Protein 4)

Produktübersicht

• Artikelname: CXXC4, Recombinant, Human, aa1-198, GST-Tag (CXXC-type Zinc Finger Protein 4)
• Artikelnummer: USB-372939
• Hersteller Artikelnummer: 372939
• Alternativnummer: USB-372939-20,USB-372939-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1. Source: Recombinant protein corresponding to aa1-198 from human CXXC4, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.0kD Amino Acid Sequence: MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 48
• UniProt: Q9H2H0
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.