CXXC4, Recombinant, Human, aa1-198, GST-Tag (CXXC-type Zinc Finger Protein 4)

Catalog Number: USB-372939
Article Name: CXXC4, Recombinant, Human, aa1-198, GST-Tag (CXXC-type Zinc Finger Protein 4)
Biozol Catalog Number: USB-372939
Supplier Catalog Number: 372939
Alternative Catalog Number: USB-372939-20,USB-372939-100
Manufacturer: US Biological
Category: Molekularbiologie
Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1. Source: Recombinant protein corresponding to aa1-198 from human CXXC4, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.0kD Amino Acid Sequence: MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 48
UniProt: Q9H2H0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.