DEFB130, Recombinant, Human, aa23-79, His-Tag (Beta-defensin 130)

Produktübersicht

• Artikelname: DEFB130, Recombinant, Human, aa23-79, His-Tag (Beta-defensin 130)
• Artikelnummer: USB-373029
• Hersteller Artikelnummer: 373029
• Alternativnummer: USB-373029-20,USB-373029-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Has antibacterial activity. Source: Recombinant protein corresponding to aa23-79 from human DEFB130, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8.3kD Amino Acid Sequence: GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 8.3
• UniProt: Q30KQ2
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.