DEFB130, Recombinant, Human, aa23-79, His-Tag (Beta-defensin 130)

Catalog Number: USB-373029
Article Name: DEFB130, Recombinant, Human, aa23-79, His-Tag (Beta-defensin 130)
Biozol Catalog Number: USB-373029
Supplier Catalog Number: 373029
Alternative Catalog Number: USB-373029-20,USB-373029-100
Manufacturer: US Biological
Category: Molekularbiologie
Has antibacterial activity. Source: Recombinant protein corresponding to aa23-79 from human DEFB130, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8.3kD Amino Acid Sequence: GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 8.3
UniProt: Q30KQ2
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.