Heat-labile Enterotoxin B Chain, Recombinant, E. coli, aa22-124, His-Tag (eltB)
Artikelnummer:
USB-373174
Hersteller Artikelnummer:
373174
Alternativnummer:
USB-373174-20, USB-373174-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase. Source: Recombinant protein corresponding to aa22-124 from E. coli Heat-labile Enterotoxin B Chain, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.7kD Amino Acid Sequence: APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten