Heat-labile Enterotoxin B Chain, Recombinant, E. coli, aa22-124, His-Tag (eltB)

Product Overview

• Article Name: Heat-labile Enterotoxin B Chain, Recombinant, E. coli, aa22-124, His-Tag (eltB)
• Biozol Catalog Number: USB-373174
• Supplier Catalog Number: 373174
• Alternative Catalog Number: USB-373174-20, USB-373174-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase. Source: Recombinant protein corresponding to aa22-124 from E. coli Heat-labile Enterotoxin B Chain, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.7kD Amino Acid Sequence: APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Molecular Weight: 15.7
• UniProt: P0CK94
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.