EutC, Recombinant, E. coli, aa1-295, His-Tag (Ethanolamine Ammonia-lyase Light Chain)

Produktübersicht

• Artikelname: EutC, Recombinant, E. coli, aa1-295, His-Tag (Ethanolamine Ammonia-lyase Light Chain)
• Artikelnummer: USB-373242
• Hersteller Artikelnummer: 373242
• Alternativnummer: USB-373242-20,USB-373242-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Full length recombinant protein corresponding to aa1-295 from E. coli Ethanolamine Ammonia-lyase Light Chain, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.9kD Amino Acid Sequence: MDQKQIEEIVRSVMASMGQAAPAPSEAKCATTNCAAPVTSESCALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 35.9
• UniProt: P19636
• Reinheit: ~90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.