EutC, Recombinant, E. coli, aa1-295, His-Tag (Ethanolamine Ammonia-lyase Light Chain)
Biozol Catalog Number:
USB-373242
Supplier Catalog Number:
373242
Alternative Catalog Number:
USB-373242-20,USB-373242-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Source: Full length recombinant protein corresponding to aa1-295 from E. coli Ethanolamine Ammonia-lyase Light Chain, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.9kD Amino Acid Sequence: MDQKQIEEIVRSVMASMGQAAPAPSEAKCATTNCAAPVTSESCALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted