FCRL6, Recombinant, Human, aa20-307, His-Tag (Fc Receptor-like Protein 6)

Produktübersicht

• Artikelname: FCRL6, Recombinant, Human, aa20-307, His-Tag (Fc Receptor-like Protein 6)
• Artikelnummer: USB-373304
• Hersteller Artikelnummer: 373304
• Alternativnummer: USB-373304-20, USB-373304-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Recombinant protein corresponding to aa20-307 from human FCRL6, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~33.7kD Amino Acid Sequence: LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 33.7
• UniProt: Q6DN72
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 10mM Tris-HCl, 1mM EDTA, 6% trehalose, pH 8.0. Reconstitute with sterile dH2O to 0.1-1mg/ml.