FCRL6, Recombinant, Human, aa20-307, His-Tag (Fc Receptor-like Protein 6)
Biozol Catalog Number:
USB-373304
Supplier Catalog Number:
373304
Alternative Catalog Number:
USB-373304-20, USB-373304-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Recombinant protein corresponding to aa20-307 from human FCRL6, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~33.7kD Amino Acid Sequence: LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.