FGF14, Recombinant, Human, aa1-252, GST-Tag (Fibroblast Growth Factor 14)

Artikelnummer: USB-373319
Artikelname: FGF14, Recombinant, Human, aa1-252, GST-Tag (Fibroblast Growth Factor 14)
Artikelnummer: USB-373319
Hersteller Artikelnummer: 373319
Alternativnummer: USB-373319-20, USB-373319-100, USB-373319-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Probably involved in nervous system development and function. Source: Recombinant protein corresponding to aa1-252 from human FGF14, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~55.5kD Amino Acid Sequence: MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 55.5
UniProt: Q92915
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.