FGF14, Recombinant, Human, aa1-252, GST-Tag (Fibroblast Growth Factor 14)

Catalog Number: USB-373319
Article Name: FGF14, Recombinant, Human, aa1-252, GST-Tag (Fibroblast Growth Factor 14)
Biozol Catalog Number: USB-373319
Supplier Catalog Number: 373319
Alternative Catalog Number: USB-373319-20,USB-373319-100,USB-373319-1
Manufacturer: US Biological
Category: Molekularbiologie
Probably involved in nervous system development and function. Source: Recombinant protein corresponding to aa1-252 from human FGF14, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~55.5kD Amino Acid Sequence: MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 55.5
UniProt: Q92915
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.