GNB1L, Recombinant, Human, aa1-327, GST-Tag (Guanine Nucleotide-binding Protein Subunit beta-like Protein 1)

Produktübersicht

• Artikelname: GNB1L, Recombinant, Human, aa1-327, GST-Tag (Guanine Nucleotide-binding Protein Subunit beta-like Protein 1)
• Artikelnummer: USB-373488
• Hersteller Artikelnummer: 373488
• Alternativnummer: USB-373488-20, USB-373488-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant full length protein corresponding to aa1-327 from human GNB1L, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~62.6kD Amino Acid Sequence: MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 62.6
• UniProt: Q9BYB4
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.