GNB1L, Recombinant, Human, aa1-327, GST-Tag (Guanine Nucleotide-binding Protein Subunit beta-like Protein 1)

Catalog Number: USB-373488
Article Name: GNB1L, Recombinant, Human, aa1-327, GST-Tag (Guanine Nucleotide-binding Protein Subunit beta-like Protein 1)
Biozol Catalog Number: USB-373488
Supplier Catalog Number: 373488
Alternative Catalog Number: USB-373488-20,USB-373488-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant full length protein corresponding to aa1-327 from human GNB1L, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~62.6kD Amino Acid Sequence: MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 62.6
UniProt: Q9BYB4
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.