GPD1, Recombinant, Human, aa1-349, His-SUMO-Tag (Glycerol-3-phosphate Dehydrogenase [NAD(+)], Cytoplasmic Domain)

Produktübersicht

• Artikelname: GPD1, Recombinant, Human, aa1-349, His-SUMO-Tag (Glycerol-3-phosphate Dehydrogenase [NAD(+)], Cytoplasmic Domain)
• Artikelnummer: USB-373511
• Hersteller Artikelnummer: 373511
• Alternativnummer: USB-373511-20,USB-373511-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-349 from human GPD1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.6kD Amino Acid Sequence: MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPD

Produkteigenschaften

• Molekulargewicht: 53.6
• UniProt: P21695
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.