GPD1, Recombinant, Human, aa1-349, His-SUMO-Tag (Glycerol-3-phosphate Dehydrogenase [NAD(+)], Cytoplasmic Domain)

Product Overview

• Article Name: GPD1, Recombinant, Human, aa1-349, His-SUMO-Tag (Glycerol-3-phosphate Dehydrogenase [NAD(+)], Cytoplasmic Domain)
• Biozol Catalog Number: USB-373511
• Supplier Catalog Number: 373511
• Alternative Catalog Number: USB-373511-20,USB-373511-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-349 from human GPD1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.6kD Amino Acid Sequence: MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPD

Product Properties

• Molecular Weight: 53.6
• UniProt: P21695
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.