GRPEL1, Recombinant, Human, aa1-217, GST-Tag (GrpE Protein Homolog 1, Mitochondrial)

Artikelnummer: USB-373534
Artikelname: GRPEL1, Recombinant, Human, aa1-217, GST-Tag (GrpE Protein Homolog 1, Mitochondrial)
Artikelnummer: USB-373534
Hersteller Artikelnummer: 373534
Alternativnummer: USB-373534-20,USB-373534-100,USB-373534-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Source: Recombinant protein corresponding to aa1-217 from human GRPEL1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.3kD Amino Acid Sequence: CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 48.3
UniProt: Q9HAV7
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.