Gstp1, Recombinant, Rat, aa2-210, His-Tag (Glutathione S-transferase P)

Artikelnummer: USB-373548
Artikelname: Gstp1, Recombinant, Rat, aa2-210, His-Tag (Glutathione S-transferase P)
Artikelnummer: USB-373548
Hersteller Artikelnummer: 373548
Alternativnummer: USB-373548-20,USB-373548-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Full length recombinant protein corresponding to aa2-210 from rat Gstp1, fused to 6X His-Tag at N-terminal, expressed in E. coli Swiss/UniProt Accession: P04906. Molecular Weight: ~27.3kD Amino Acid Sequence: PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.3
UniProt: P04906
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol