Gstp1, Recombinant, Rat, aa2-210, His-Tag (Glutathione S-transferase P)
Biozol Catalog Number:
USB-373548
Supplier Catalog Number:
373548
Alternative Catalog Number:
USB-373548-20, USB-373548-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Full length recombinant protein corresponding to aa2-210 from rat Gstp1, fused to 6X His-Tag at N-terminal, expressed in E. coli Swiss/UniProt Accession: P04906. Molecular Weight: ~27.3kD Amino Acid Sequence: PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
