HLA-DQB1, Recombinant, Human, aa33-227, His-Tag (MHC Class II Antigen)

Artikelnummer: USB-373645
Artikelname: HLA-DQB1, Recombinant, Human, aa33-227, His-Tag (MHC Class II Antigen)
Artikelnummer: USB-373645
Hersteller Artikelnummer: 373645
Alternativnummer: USB-373645-20,USB-373645-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Partial recombinant protein corresponding to aa33-227 from human MHC Class II Antigen, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.7kD Amino Acid Sequence: RDSPEDFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRRVEPTVTISPSRTEALNHHNLLICSVTDFYPSQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.7
UniProt: Q5Y7D0
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.