HLA-DQB1, Recombinant, Human, aa33-227, His-Tag (MHC Class II Antigen)

Product Overview

• Article Name: HLA-DQB1, Recombinant, Human, aa33-227, His-Tag (MHC Class II Antigen)
• Biozol Catalog Number: USB-373645
• Supplier Catalog Number: 373645
• Alternative Catalog Number: USB-373645-20, USB-373645-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Partial recombinant protein corresponding to aa33-227 from human MHC Class II Antigen, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.7kD Amino Acid Sequence: RDSPEDFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRRVEPTVTISPSRTEALNHHNLLICSVTDFYPSQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 26.7
• UniProt: Q5Y7D0
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.