ICA1, Recombinant, Human, aa1-268, His-Tag (Islet Cell Autoantigen 1)

Artikelnummer: USB-373718
Artikelname: ICA1, Recombinant, Human, aa1-268, His-Tag (Islet Cell Autoantigen 1)
Artikelnummer: USB-373718
Hersteller Artikelnummer: 373718
Alternativnummer: USB-373718-20,USB-373718-100,USB-373718-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May play a role in neurotransmitter secretion. Source: Recombinant protein corresponding to aa1-268 from human ICA1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.5kD Amino Acid Sequence: MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.5
UniProt: Q05084
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.