ICA1, Recombinant, Human, aa1-268, His-Tag (Islet Cell Autoantigen 1)

Catalog Number: USB-373718
Article Name: ICA1, Recombinant, Human, aa1-268, His-Tag (Islet Cell Autoantigen 1)
Biozol Catalog Number: USB-373718
Supplier Catalog Number: 373718
Alternative Catalog Number: USB-373718-20,USB-373718-100,USB-373718-1
Manufacturer: US Biological
Category: Molekularbiologie
May play a role in neurotransmitter secretion. Source: Recombinant protein corresponding to aa1-268 from human ICA1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.5kD Amino Acid Sequence: MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.5
UniProt: Q05084
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.