Ice-structuring Protein Lambda OP-3, Recombinant, Zoarces americanus, aa23-91, His-Tag (ISP lambda OP-3)

Artikelnummer: USB-373723
Artikelname: Ice-structuring Protein Lambda OP-3, Recombinant, Zoarces americanus, aa23-91, His-Tag (ISP lambda OP-3)
Artikelnummer: USB-373723
Hersteller Artikelnummer: 373723
Alternativnummer: USB-373723-20,USB-373723-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity). Source: Recombinant protein corresponding to aa23-91 from zoarces americanus Ice-structuring protein lambda OP-3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.6kD Amino Acid Sequence: NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.6
UniProt: P19606
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.