Ice-structuring Protein Lambda OP-3, Recombinant, Zoarces americanus, aa23-91, His-Tag (ISP lambda OP-3)

Product Overview

• Article Name: Ice-structuring Protein Lambda OP-3, Recombinant, Zoarces americanus, aa23-91, His-Tag (ISP lambda OP-3)
• Biozol Catalog Number: USB-373723
• Supplier Catalog Number: 373723
• Alternative Catalog Number: USB-373723-20, USB-373723-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity). Source: Recombinant protein corresponding to aa23-91 from zoarces americanus Ice-structuring protein lambda OP-3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.6kD Amino Acid Sequence: NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 11.6
• UniProt: P19606
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.