KLRC2, Recombinant, Human, aa94-231, His-SUMO-Tag (NKG2-C type II Integral Membrane Protein)

Artikelnummer: USB-373939
Artikelname: KLRC2, Recombinant, Human, aa94-231, His-SUMO-Tag (NKG2-C type II Integral Membrane Protein)
Artikelnummer: USB-373939
Hersteller Artikelnummer: 373939
Alternativnummer: USB-373939-20,USB-373939-100,USB-373939-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. Source: Recombinant protein corresponding to aa94-231 from human KLRC2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.8kD Amino Acid Sequence: IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.8
UniProt: P26717
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.