KLRC2, Recombinant, Human, aa94-231, His-SUMO-Tag (NKG2-C type II Integral Membrane Protein)
Biozol Catalog Number:
USB-373939
Supplier Catalog Number:
373939
Alternative Catalog Number:
USB-373939-20,USB-373939-100,USB-373939-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. Source: Recombinant protein corresponding to aa94-231 from human KLRC2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.8kD Amino Acid Sequence: IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted