PAM16, Recombinant, Human, aa1-125, GST-Tag (Mitochondrial Import Inner Membrane Translocase Subunit TIM16)

Artikelnummer: USB-374606
Artikelname: PAM16, Recombinant, Human, aa1-125, GST-Tag (Mitochondrial Import Inner Membrane Translocase Subunit TIM16)
Artikelnummer: USB-374606
Hersteller Artikelnummer: 374606
Alternativnummer: USB-374606-20,USB-374606-100,USB-374606-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity. Source: Recombinant protein corresponding to aa1-125 from human PAM16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.8kD Amino Acid Sequence: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 40.8
UniProt: Q9Y3D7
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.