PAM16, Recombinant, Human, aa1-125, GST-Tag (Mitochondrial Import Inner Membrane Translocase Subunit TIM16)

Product Overview

• Article Name: PAM16, Recombinant, Human, aa1-125, GST-Tag (Mitochondrial Import Inner Membrane Translocase Subunit TIM16)
• Biozol Catalog Number: USB-374606
• Supplier Catalog Number: 374606
• Alternative Catalog Number: USB-374606-20,USB-374606-100,USB-374606-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity. Source: Recombinant protein corresponding to aa1-125 from human PAM16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.8kD Amino Acid Sequence: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 40.8
• UniProt: Q9Y3D7
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.