Plaur, Recombinant, Rat, aa1-178, His-Tag (Urokinase Plasminogen Activator Surface Rreceptor)

Produktübersicht

• Artikelname: Plaur, Recombinant, Rat, aa1-178, His-Tag (Urokinase Plasminogen Activator Surface Rreceptor)
• Artikelnummer: USB-374738
• Hersteller Artikelnummer: 374738
• Alternativnummer: USB-374738-20,USB-374738-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. Source: Recombinant protein corresponding to aa1-178 from rat PLAUR, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.9kD Amino Acid Sequence: LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 23.9
• UniProt: P49616
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.