Plaur, Recombinant, Rat, aa1-178, His-Tag (Urokinase Plasminogen Activator Surface Rreceptor)

Product Overview

• Article Name: Plaur, Recombinant, Rat, aa1-178, His-Tag (Urokinase Plasminogen Activator Surface Rreceptor)
• Biozol Catalog Number: USB-374738
• Supplier Catalog Number: 374738
• Alternative Catalog Number: USB-374738-20,USB-374738-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. Source: Recombinant protein corresponding to aa1-178 from rat PLAUR, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.9kD Amino Acid Sequence: LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 23.9
• UniProt: P49616
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.