RAB27B, Recombinant, Human, aa2-218, His-SUMO-Tag (Ras-related Protein Rab-27B)

Artikelnummer: USB-374968
Artikelname: RAB27B, Recombinant, Human, aa2-218, His-SUMO-Tag (Ras-related Protein Rab-27B)
Artikelnummer: USB-374968
Hersteller Artikelnummer: 374968
Alternativnummer: USB-374968-20,USB-374968-100,USB-374968-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May be involved in targeting uroplakins to urothelial apical membranes. Source: Recombinant protein corresponding to aa2-218 from human RAB27B, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.5kD Amino Acid Sequence: TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 40.5
UniProt: O00194
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.