RAB27B, Recombinant, Human, aa2-218, His-SUMO-Tag (Ras-related Protein Rab-27B)

Product Overview

• Article Name: RAB27B, Recombinant, Human, aa2-218, His-SUMO-Tag (Ras-related Protein Rab-27B)
• Biozol Catalog Number: USB-374968
• Supplier Catalog Number: 374968
• Alternative Catalog Number: USB-374968-20,USB-374968-100,USB-374968-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May be involved in targeting uroplakins to urothelial apical membranes. Source: Recombinant protein corresponding to aa2-218 from human RAB27B, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.5kD Amino Acid Sequence: TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 40.5
• UniProt: O00194
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.